AP3S1 antibody

Name AP3S1 antibody
Supplier Fitzgerald
Catalog 70R-3826
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen AP3S1 antibody was raised using the N terminal of AP3S1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE
Purity/Format Affinity purified
Blocking Peptide AP3S1 Blocking Peptide
Description Rabbit polyclonal AP3S1 antibody raised against the N terminal of AP3S1
Gene AP3S1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.