Name | AP3S1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3826 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | AP3S1 antibody was raised using the N terminal of AP3S1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE |
Purity/Format | Affinity purified |
Blocking Peptide | AP3S1 Blocking Peptide |
Description | Rabbit polyclonal AP3S1 antibody raised against the N terminal of AP3S1 |
Gene | AP3S1 |
Supplier Page | Shop |