| Name | LAB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2191 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Drosophila |
| Antigen | LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL |
| Purity/Format | Affinity purified |
| Blocking Peptide | LAB Blocking Peptide |
| Description | Rabbit polyclonal LAB antibody raised against the N terminal Of Lab |
| Gene | lab |
| Supplier Page | Shop |