| Name | PNPO antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2576 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PNPO antibody was raised using the N terminal of PNPO corresponding to a region with amino acids PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT |
| Purity/Format | Affinity purified |
| Blocking Peptide | PNPO Blocking Peptide |
| Description | Rabbit polyclonal PNPO antibody raised against the N terminal of PNPO |
| Gene | PNPO |
| Supplier Page | Shop |