| Name | KREMEN1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6624 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids WKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQR |
| Purity/Format | Affinity purified |
| Blocking Peptide | KREMEN1 Blocking Peptide |
| Description | Rabbit polyclonal KREMEN1 antibody raised against the N terminal of KREMEN1 |
| Gene | KREMEN1 |
| Supplier Page | Shop |