C12ORF4 antibody

Name C12ORF4 antibody
Supplier Fitzgerald
Catalog 70R-3506
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C12ORF4 antibody was raised using the N terminal Of C12Orf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS
Purity/Format Affinity purified
Blocking Peptide C12ORF4 Blocking Peptide
Description Rabbit polyclonal C12ORF4 antibody raised against the N terminal Of C12Orf4
Gene C12orf4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.