| Name | SPATA24 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4050 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SPATA24 antibody was raised using the C terminal of SPATA24 corresponding to a region with amino acids LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | SPATA24 Blocking Peptide |
| Description | Rabbit polyclonal SPATA24 antibody raised against the c terminal of SPATA24 |
| Gene | SPATA24 |
| Supplier Page | Shop |