| Name | RAI14 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4242 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAE |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAI14 Blocking Peptide |
| Description | Rabbit polyclonal RAI14 antibody raised against the middle region of RAI14 |
| Gene | RAI14 |
| Supplier Page | Shop |