| Name | GNS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7202 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA |
| Purity/Format | Affinity purified |
| Blocking Peptide | GNS Blocking Peptide |
| Description | Rabbit polyclonal GNS antibody raised against the C terminal of GNS |
| Gene | GNS |
| Supplier Page | Shop |