Name | IQCD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4434 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | IQCD antibody was raised using the middle region of IQCD corresponding to a region with amino acids CLKEKERQLQEQKEAEEEGWLRDRLLSIELQKSSLSPLMQQIKDSTKNVL |
Purity/Format | Affinity purified |
Blocking Peptide | IQCD Blocking Peptide |
Description | Rabbit polyclonal IQCD antibody raised against the middle region of IQCD |
Gene | IQCD |
Supplier Page | Shop |