| Name | AUH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4818 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | AUH antibody was raised using the C terminal of AUH corresponding to a region with amino acids IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE |
| Purity/Format | Affinity purified |
| Blocking Peptide | AUH Blocking Peptide |
| Description | Rabbit polyclonal AUH antibody raised against the C terminal of AUH |
| Gene | AGMAT |
| Supplier Page | Shop |