| Name | ST6GALNAC5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1903 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ST6GALNAC5 antibody was raised using the middle region of ST6GALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ST6GALNAC5 Blocking Peptide |
| Description | Rabbit polyclonal ST6GALNAC5 antibody raised against the middle region of ST6GALNAC5 |
| Gene | ST6GALNAC5 |
| Supplier Page | Shop |