Neurexophilin 3 antibody

Name Neurexophilin 3 antibody
Supplier Fitzgerald
Catalog 70R-4471
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT
Purity/Format Affinity purified
Blocking Peptide Neurexophilin 3 Blocking Peptide
Description Rabbit polyclonal Neurexophilin 3 antibody raised against the middle region of NXPH3
Gene NXPH3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.