| Name | SPRR3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3927 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SPRR3 antibody was raised using the middle region of SPRR3 corresponding to a region with amino acids DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | SPRR3 Blocking Peptide |
| Description | Rabbit polyclonal SPRR3 antibody raised against the middle region of SPRR3 |
| Gene | SPRR3 |
| Supplier Page | Shop |