SPRR3 antibody

Name SPRR3 antibody
Supplier Fitzgerald
Catalog 70R-3927
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SPRR3 antibody was raised using the middle region of SPRR3 corresponding to a region with amino acids DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ
Purity/Format Affinity purified
Blocking Peptide SPRR3 Blocking Peptide
Description Rabbit polyclonal SPRR3 antibody raised against the middle region of SPRR3
Gene SPRR3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.