| Name | GRIN2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5207 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GRIN2A antibody was raised using the middle region of GRIN2A corresponding to a region with amino acids DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
| Purity/Format | Affinity purified |
| Blocking Peptide | GRIN2A Blocking Peptide |
| Description | Rabbit polyclonal GRIN2A antibody raised against the middle region of GRIN2A |
| Gene | GRIN2A |
| Supplier Page | Shop |