| Name | HNRPH1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4663 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
| Purity/Format | Affinity purified |
| Blocking Peptide | HNRPH1 Blocking Peptide |
| Description | Rabbit polyclonal HNRPH1 antibody raised against the middle region of Hnrph1 |
| Gene | HNRNPH1 |
| Supplier Page | Shop |