Name | USP36 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3767 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV |
Purity/Format | Affinity purified |
Blocking Peptide | USP36 Blocking Peptide |
Description | Rabbit polyclonal USP36 antibody raised against the N terminal of USP36 |
Gene | USP36 |
Supplier Page | Shop |