| Name | OGDH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3029 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL |
| Purity/Format | Affinity purified |
| Blocking Peptide | OGDH Blocking Peptide |
| Description | Rabbit polyclonal OGDH antibody raised against the N terminal of OGDH |
| Gene | OGDH |
| Supplier Page | Shop |