| Name | MFSD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6533 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MFSD1 antibody was raised using the middle region of MFSD1 corresponding to a region with amino acids RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM |
| Purity/Format | Affinity purified |
| Blocking Peptide | MFSD1 Blocking Peptide |
| Description | Rabbit polyclonal MFSD1 antibody raised against the middle region of MFSD1 |
| Gene | MFSD1 |
| Supplier Page | Shop |