| Name | CLIC6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5047 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CLIC6 Blocking Peptide |
| Description | Rabbit polyclonal CLIC6 antibody raised against the middle region of CLIC6 |
| Gene | CLIC6 |
| Supplier Page | Shop |