| Name | P450 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1780 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | P450 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | P450 Blocking Peptide |
| Description | Rabbit polyclonal P450 antibody |
| Gene | POR |
| Supplier Page | Shop |