| Name | LRRC28 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4151 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | LRRC28 antibody was raised using the C terminal of LRRC28 corresponding to a region with amino acids KDLNFLSPISLPRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMA |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC28 Blocking Peptide |
| Description | Rabbit polyclonal LRRC28 antibody raised against the C terminal of LRRC28 |
| Gene | LRRC28 |
| Supplier Page | Shop |