Name | Lamin B Receptor antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6757 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL |
Purity/Format | Affinity purified |
Blocking Peptide | Lamin B Receptor Blocking Peptide |
Description | Rabbit polyclonal Lamin B Receptor antibody raised against the middle region of LBR |
Gene | LBR |
Supplier Page | Shop |