| Name | Lamin B Receptor antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6757 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Lamin B Receptor Blocking Peptide |
| Description | Rabbit polyclonal Lamin B Receptor antibody raised against the middle region of LBR |
| Gene | LBR |
| Supplier Page | Shop |