| Name | CAMK1D antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3991 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CAMK1D antibody was raised using the middle region of CAMK1D corresponding to a region with amino acids KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | CAMK1D Blocking Peptide |
| Description | Rabbit polyclonal CAMK1D antibody raised against the middle region of CAMK1D |
| Gene | CAMK1D |
| Supplier Page | Shop |