| Name | GSDML antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2356 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GSDML antibody was raised using the N terminal of GSDML corresponding to a region with amino acids HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL |
| Purity/Format | Affinity purified |
| Blocking Peptide | GSDML Blocking Peptide |
| Description | Rabbit polyclonal GSDML antibody raised against the N terminal of GSDML |
| Gene | GSDMB |
| Supplier Page | Shop |