| Name | FNDC4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6597 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FNDC4 Blocking Peptide |
| Description | Rabbit polyclonal FNDC4 antibody raised against the middle region of FNDC4 |
| Gene | FNDC4 |
| Supplier Page | Shop |