| Name | RIBC1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4023 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RIBC1 antibody was raised using the middle region of RIBC1 corresponding to a region with amino acids ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM |
| Purity/Format | Affinity purified |
| Blocking Peptide | RIBC1 Blocking Peptide |
| Description | Rabbit polyclonal RIBC1 antibody raised against the middle region of RIBC1 |
| Gene | RIBC1 |
| Supplier Page | Shop |