| Name | ILDR1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7528 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ILDR1 Blocking Peptide |
| Description | Rabbit polyclonal ILDR1 antibody raised against the middle region of ILDR1 |
| Gene | ILDR1 |
| Supplier Page | Shop |