Name | ILDR1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7528 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV |
Purity/Format | Affinity purified |
Blocking Peptide | ILDR1 Blocking Peptide |
Description | Rabbit polyclonal ILDR1 antibody raised against the middle region of ILDR1 |
Gene | ILDR1 |
Supplier Page | Shop |