| Name | LGALS3BP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6085 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | LGALS3BP antibody was raised using the middle region of LGALS3BP corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS |
| Purity/Format | Affinity purified |
| Blocking Peptide | LGALS3BP Blocking Peptide |
| Description | Rabbit polyclonal LGALS3BP antibody raised against the middle region of LGALS3BP |
| Gene | LGALS3BP |
| Supplier Page | Shop |