Name | LGALS3BP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6085 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | LGALS3BP antibody was raised using the middle region of LGALS3BP corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS |
Purity/Format | Affinity purified |
Blocking Peptide | LGALS3BP Blocking Peptide |
Description | Rabbit polyclonal LGALS3BP antibody raised against the middle region of LGALS3BP |
Gene | LGALS3BP |
Supplier Page | Shop |