PARP16 antibody

Name PARP16 antibody
Supplier Fitzgerald
Catalog 70R-6277
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL
Purity/Format Affinity purified
Blocking Peptide PARP16 Blocking Peptide
Description Rabbit polyclonal PARP16 antibody
Gene PARP16
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.