| Name | KCTD6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1490 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids LRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KCTD6 Blocking Peptide |
| Description | Rabbit polyclonal KCTD6 antibody raised against the N terminal of KCTD6 |
| Gene | KCTD6 |
| Supplier Page | Shop |