UGT1A1 antibody

• Supplier: Fitzgerald
• Catalog: 70R-1876
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: UGT1A1 antibody was raised using the middle region of UGT1A1 corresponding to a region with amino acids ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: UGT1A1 Blocking Peptide
• Description: Rabbit polyclonal UGT1A1 antibody raised against the middle region of UGT1A1
• Gene: UGT1A