KIAA0157 antibody

Name KIAA0157 antibody
Supplier Fitzgerald
Catalog 70R-4247
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen KIAA0157 antibody was raised using the middle region of Kiaa0157 corresponding to a region with amino acids GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI
Purity/Format Affinity purified
Blocking Peptide KIAA0157 Blocking Peptide
Description Rabbit polyclonal KIAA0157 antibody raised against the middle region of Kiaa0157
Gene FAM175B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.