| Name | PRPH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2613 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PRPH antibody was raised using the middle region of PRPH corresponding to a region with amino acids YKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRPH Blocking Peptide |
| Description | Rabbit polyclonal PRPH antibody raised against the middle region of PRPH |
| Gene | PRPH |
| Supplier Page | Shop |