| Name | RNF39 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1169 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RNF39 Blocking Peptide |
| Description | Rabbit polyclonal RNF39 antibody raised against the C terminal of RNF39 |
| Gene | RNF39 |
| Supplier Page | Shop |