SLMO2 antibody

Name SLMO2 antibody
Supplier Fitzgerald
Catalog 70R-4343
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLMO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV
Purity/Format Affinity purified
Blocking Peptide SLMO2 Blocking Peptide
Description Rabbit polyclonal SLMO2 antibody
Gene SLMO2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.