| Name | ZDHHC14 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7047 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ZDHHC14 antibody was raised using the N terminal of ZDHHC14 corresponding to a region with amino acids TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZDHHC14 Blocking Peptide |
| Description | Rabbit polyclonal ZDHHC14 antibody raised against the N terminal of ZDHHC14 |
| Gene | ZDHHC14 |
| Supplier Page | Shop |