| Name | RPL8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1426 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RPL8 Blocking Peptide |
| Description | Rabbit polyclonal RPL8 antibody raised against the C terminal of RPL8 |
| Gene | RPL8 |
| Supplier Page | Shop |