| Name | DHODH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6501 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG |
| Purity/Format | Affinity purified |
| Blocking Peptide | DHODH Blocking Peptide |
| Description | Rabbit polyclonal DHODH antibody raised against the N terminal of DHODH |
| Gene | DHODH |
| Supplier Page | Shop |