| Name | EIF5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3190 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT |
| Purity/Format | Affinity purified |
| Blocking Peptide | EIF5 Blocking Peptide |
| Description | Rabbit polyclonal EIF5 antibody raised against the N terminal of EIF5 |
| Gene | EIF5 |
| Supplier Page | Shop |