| Name | RAPSN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2650 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAPSN Blocking Peptide |
| Description | Rabbit polyclonal RAPSN antibody raised against the N terminal of RAPSN |
| Gene | RAPSN |
| Supplier Page | Shop |