| Name | FKTN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1753 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Rat, Dog |
| Antigen | FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FKTN Blocking Peptide |
| Description | Rabbit polyclonal FKTN antibody raised against the N terminal Of Fktn |
| Gene | FKTN |
| Supplier Page | Shop |