| Name | KIFAP3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3387 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIFAP3 Blocking Peptide |
| Description | Rabbit polyclonal KIFAP3 antibody raised against the middle region of KIFAP3 |
| Gene | MASP2 |
| Supplier Page | Shop |