| Name | RHOC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5758 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, C. elegans, Drosophila |
| Antigen | RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
| Purity/Format | Affinity purified |
| Blocking Peptide | RHOC Blocking Peptide |
| Description | Rabbit polyclonal RHOC antibody raised against the N terminal of RHOC |
| Gene | GPR50 |
| Supplier Page | Shop |