Name | RHOC antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5758 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog, C. elegans, Drosophila |
Antigen | RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Purity/Format | Affinity purified |
Blocking Peptide | RHOC Blocking Peptide |
Description | Rabbit polyclonal RHOC antibody raised against the N terminal of RHOC |
Gene | GPR50 |
Supplier Page | Shop |