Name | GALNT14 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7437 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | GALNT14 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA |
Purity/Format | Affinity purified |
Blocking Peptide | GALNT14 Blocking Peptide |
Description | Rabbit polyclonal GALNT14 antibody |
Gene | GALNT14 |
Supplier Page | Shop |