| Name | GAPDHS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3034 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI |
| Purity/Format | Affinity purified |
| Blocking Peptide | GAPDHS Blocking Peptide |
| Description | Rabbit polyclonal GAPDHS antibody raised against the N terminal of GAPDHS |
| Gene | GAPDHS |
| Supplier Page | Shop |