Name | Mesothelin antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6186 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAF |
Purity/Format | Affinity purified |
Blocking Peptide | Mesothelin Blocking Peptide |
Description | Rabbit polyclonal Mesothelin antibody raised against the middle region of MSLN |
Gene | MSLN |
Supplier Page | Shop |