| Name | CLECL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2329 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CLECL1 antibody was raised using the middle region of CLECL1 corresponding to a region with amino acids FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK |
| Purity/Format | Affinity purified |
| Blocking Peptide | CLECL1 Blocking Peptide |
| Description | Rabbit polyclonal CLECL1 antibody raised against the middle region of CLECL1 |
| Gene | CLECL1 |
| Supplier Page | Shop |