PTRH2 antibody

Name PTRH2 antibody
Supplier Fitzgerald
Catalog 70R-1785
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PTRH2 antibody was raised using the C terminal of PTRH2 corresponding to a region with amino acids RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT
Purity/Format Total IgG Protein A purified
Blocking Peptide PTRH2 Blocking Peptide
Description Rabbit polyclonal PTRH2 antibody raised against the C terminal of PTRH2
Gene PTRH2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.