| Name | GFOD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3804 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GFOD1 antibody was raised using the middle region of GFOD1 corresponding to a region with amino acids NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT |
| Purity/Format | Affinity purified |
| Blocking Peptide | GFOD1 Blocking Peptide |
| Description | Rabbit polyclonal GFOD1 antibody raised against the middle region of GFOD1 |
| Gene | GFOD1 |
| Supplier Page | Shop |