TOM1 antibody

Name TOM1 antibody
Supplier Fitzgerald
Catalog 70R-4060
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA
Purity/Format Affinity purified
Blocking Peptide TOM1 Blocking Peptide
Description Rabbit polyclonal TOM1 antibody
Gene TOM1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.